£0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Selenite Spiral Pointed Wand
Selenite Spiral Pointed Wand
Selenite Spiral Pointed Wand
£12.00 inc. tax
Selenite Spiral Pointed Wand - Approx 15cm


Selenite
Spiritual & Personal Growth | Cleansing
Expanding awareness to the higher planes of consciousness, Selenite attunes to receiving messages from your guardian angels and spirit guides. Aligning your intention for serving the highest good, it empowers an enlightened transformation. Directing the flow of energy throughout the body, it cleanses the aura and dissolves any blockages.
Buy
  • Buy
  • Product Details
    • Selenite Spiral Pointed Wand
    £12.00 inc. tax
    Buy
    Add to Cart
    Product Code: 1063
    Product Condition: New
    Updating Order Details
    Please do not refresh or navigate away from the page!
    Reviews
    Reviews
    No Reviews Posted Yet - be the first! write review
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore.com
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Fully loaded webstore
    Unlimited products
    Domain & SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    15+ years
    1 million stores created
    No card required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i