£0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Rose Quartz Chip Bracelet
Rose Quartz Chip Bracelet
Rose Quartz Chip Bracelet
£4.00 inc. tax
Rose Quartz Chip Bracelet. 17-20cm with a lobster clasp


Rose Quartz
Love | Emotional Healing | Calm
Nurturing a genuine appreciation for yourself, Rose Quartz inspires self-acceptance by recognizing your unique inner beauty. Releasing stress and resentment, it supports emotional healing for overcoming trauma and heartbreak. Bringing the heart chakra into balance, it calms the body into a state of infinite peace.
Buy
  • Buy
  • Product Details
    • Rose Quartz Chip Bracelet
    £4.00 inc. tax
    Buy
    Add to Cart
    Product Code: 1003
    Product Condition: New
    Updating Order Details
    Please do not refresh or navigate away from the page!
    Reviews
    Reviews
    No Reviews Posted Yet - be the first! write review
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore.com
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Fully loaded webstore
    Unlimited products
    Domain & SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    15+ years
    1 million stores created
    No card required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i