£0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Opalite Earrings
Opalite Earrings
Opalite Earrings
£5.00 inc. tax
Opalite Stud Earrings

Opalite gemstones are known for their healing properties, including the ability to alleviate depression and fatigue and calm an anxious mind. Spiritually, opalite is related to the crown and third eye chakras. It also aids communication at every level and brings positive energy to homes
Buy
  • Buy
  • Product Details
    • Opalite Earrings
    £5.00 inc. tax
    Buy
    Add to Cart
    Product Code: 1013
    Product Condition: New
    Updating Order Details
    Please do not refresh or navigate away from the page!
    Reviews
    Reviews
    No Reviews Posted Yet - be the first! write review
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore.com
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Fully loaded webstore
    Unlimited products
    Domain & SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    15+ years
    1 million stores created
    No card required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i