£0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Milky Quartz Bird Carving
Milky Quartz Bird Carving
Milky Quartz Bird Carving
£3.50 inc. tax
Milky Quartz Small Bird Carving

Milky quartz is also known as 'snow quartz' or simply 'white quartz'' It is associated with innocence and tranquillity. Milky quartz is said to help us view the world without preconceived ideas or prejudices. It is also believed to stop us being overwhelmed by strong emotions.
Buy
  • Buy
  • Product Details
    • Milky Quartz Bird Carving
    £3.50 inc. tax
    Buy
    Add to Cart
    Product Code: 1028
    Product Condition: New
    Updating Order Details
    Please do not refresh or navigate away from the page!
    Reviews
    Reviews
    No Reviews Posted Yet - be the first! write review
    Product Added to your Cart
    x

    -------- OR --------

    Create a free online store
    Powered by freewebstore.com
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Fully loaded webstore
    Unlimited products
    Domain & SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    15+ years
    1 million stores created
    No card required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i